Anti-Human IgG Rabbit Monoclonal Antibody |
|
M04575 |
BosterBio |
100ug/vial |
EUR 476.4 |
|
Description: Rabbit Monoclonal Human IgG Antibody. Validated in WB and tested in Human. |
Human IgG antibody Laboratories manufactures the first ever rabbit monoclonal antibody approved for therapeutics reagents distributed by Genprice. The First Ever Rabbit Monoclonal Antibody Approved For Therapeutics reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact rabbit Antibody. Other First products are available in stock. Specificity: First Category: Ever Group: Rabbit Monoclonal
ELISA kit for Human True insulin (TI) |
|
Abbkine |
5 plates of 96 wells |
EUR 2702.4 |
|
Description: Quantitative sandwich ELISA for measuring Human True insulin (TI) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human True insulin (TI) |
|
Abbkine |
96T |
EUR 686.4 |
|
Description: Quantitative sandwich ELISA for measuring Human True insulin (TI) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 480 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594. |
Rabbit Monoclonal information
CeraVe Therapeutic Hand Cream , 3 Oz |
|
LC3035-001 |
GenDepot |
Ea |
EUR 84 |
Recombinant Human GAA therapeutic protein |
|
GAA-P026H |
Creative BioMart |
50ug |
EUR 638.4 |
|
|
Recombinant Human GBA therapeutic protein |
|
GBA-P024H |
Creative BioMart |
10ug |
EUR 318.4 |
|
|
Recombinant Hu-rhEGF-rP64k/Mont Therapeutic Vaccine |
|
THP-0327 |
Creative BioMart |
1 vial |
EUR 2398.4 |
|
Description: Protein |
Recombinant Human CSF3 therapeutic protein |
|
CSF3-P054H |
Creative BioMart |
20ug |
EUR 158.4 |
|
|
|
Description: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Recombinant Human IDUA therapeutic protein |
|
IDUA-P025H |
Creative BioMart |
5ug |
EUR 238.4 |
|
|
|
Description: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Recombinant Human ACVR2B, Fc-tagged therapeutic protein |
|
ACVR2B-P014H |
Creative BioMart |
100ug |
EUR 958.4 |
|
|
Recombinant Human ActRIIA therapeutic protein, Fc-tagged |
|
ACVR2A-P015H |
Creative BioMart |
100ug |
EUR 958.4 |
|
|
DiscoveryProbe™ Clinical & FDA approved Drug Library |
|
L1052-.096 |
ApexBio |
100uL/well(10 mM solution),96 Well Deep Well Plate |
EUR 5968 |
|
Description: A collection of 2726 clinical & FDA approved drugs supplied as lyophilized powder or pre-dissolved DMSO solutions |
