Anti-Human IgG Rabbit Monoclonal Antibody |
M04575 |
BosterBio |
100ug/vial |
EUR 476.4 |
Description: Rabbit Monoclonal Human IgG Antibody. Validated in WB and tested in Human. |
Human IgG antibody Laboratories manufactures the first ever rabbit monoclonal antibody approved for therapeutics reagents distributed by Genprice. The First Ever Rabbit Monoclonal Antibody Approved For Therapeutics reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact rabbit Antibody. Other First products are available in stock. Specificity: First Category: Ever Group: Rabbit Monoclonal
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 471.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 477.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 564 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 474 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 495.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 482.4 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 470.4 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
Rabbit Monoclonal information
Rabbit monoclonal antibody for Candida albicans |
6405 |
Virostat |
100 ug |
EUR 503.7 |
Description: This is purified Rabbit monoclonal antibody against Candida albicans species for ELISA, IFA. |
Rabbit monoclonal antibody for Strep pneumoniae |
O493 |
Virostat |
100 ug |
EUR 503.7 |
Description: This is purified Rabbit monoclonal antibody against Strep pneumoniae common for ELISA, IFA. |
Rabbit monoclonal antibody for Strep pneumoniae |
O494 |
Virostat |
100 ug |
EUR 503.7 |
Description: This is purified Rabbit monoclonal antibody against Strep pneumoniae common for ELISA, IFA. |
Rabbit monoclonal antibody for Strep pneumoniae |
O495 |
Virostat |
100 ug |
EUR 503.7 |
Description: This is purified Rabbit monoclonal antibody against Strep pneumoniae common for ELISA, IFA. |
Rabbit monoclonal antibody for Aspergillus Species |
5145 |
Virostat |
100 ug |
EUR 503.7 |
Description: This is purified Rabbit monoclonal antibody against Aspergillus Species for ELISA, IFA. |
Rabbit monoclonal antibody for Legionella pneumophila |
6026 |
Virostat |
100 ug |
EUR 503.7 |
Description: This is purified Rabbit monoclonal antibody against Legionella pneumophila serogroup 1 for ELISA, IFA. |
Rabbit monoclonal antibody for fungal beta-glucan |
8201 |
Virostat |
100 ug |
EUR 503.7 |
Description: This is purified Rabbit monoclonal antibody against fungal beta-glucan beta-glucan for ELISA, IFA. |
Rabbit monoclonal antibody for Streptococcus group B |
1525 |
Virostat |
100 ug |
EUR 503.7 |
Description: This is purified Rabbit monoclonal antibody against Streptococcus group B group carbohydrate for ELISA, IFA. |
Rabbit monoclonal antibody for Streptococcus group A |
O435 |
Virostat |
100 ug |
EUR 503.7 |
Description: This is purified Rabbit monoclonal antibody against Streptococcus group A group carbohydrate for ELISA, IFA. |
Anti-Dnmt3b Rabbit Monoclonal Antibody Rabbit Monoclonal Antibody |
M00319 |
BosterBio |
100ug/vial |
EUR 476.4 |
Description: Rabbit Monoclonal Dnmt3b Antibody Antibody. Validated in IF, ICC, WB and tested in Human, Mouse, Rat. |