First Ever Rabbit Monoclonal Antibody Approved For Therapeutics

Anti-Human IgG Rabbit Monoclonal Antibody

M04575 100ug/vial
EUR 476.4
Description: Rabbit Monoclonal Human IgG Antibody. Validated in WB and tested in Human.

Human IgG antibody Laboratories manufactures the first ever rabbit monoclonal antibody approved for therapeutics reagents distributed by Genprice. The First Ever Rabbit Monoclonal Antibody Approved For Therapeutics reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact rabbit Antibody. Other First products are available in stock. Specificity: First Category: Ever Group: Rabbit Monoclonal

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Rabbit Monoclonal information

FBS - Heat Inactivated Qualified Imported Fetal Bovine Serum (USDA Approved)

FBS006-HI each
EUR 279

Rabbit monoclonal antibody for Mycobacteria

5179 100 ug
EUR 503.7
Description: This is purified Rabbit monoclonal antibody against Mycobacteria LAM for ELISA, IFA.

Rabbit monoclonal antibody for Mycobacteria

5180 100 ug
EUR 503.7
Description: This is purified Rabbit monoclonal antibody against Mycobacteria LAM for ELISA, IFA.

Rabbit monoclonal antibody for Candida albicans

6405 100 ug
EUR 503.7
Description: This is purified Rabbit monoclonal antibody against Candida albicans species for ELISA, IFA.

Rabbit monoclonal antibody for Strep pneumoniae

O493 100 ug
EUR 503.7
Description: This is purified Rabbit monoclonal antibody against Strep pneumoniae common for ELISA, IFA.

Rabbit monoclonal antibody for Strep pneumoniae

O494 100 ug
EUR 503.7
Description: This is purified Rabbit monoclonal antibody against Strep pneumoniae common for ELISA, IFA.

Rabbit monoclonal antibody for Strep pneumoniae

O495 100 ug
EUR 503.7
Description: This is purified Rabbit monoclonal antibody against Strep pneumoniae common for ELISA, IFA.

Rabbit monoclonal antibody for Aspergillus Species

5145 100 ug
EUR 503.7
Description: This is purified Rabbit monoclonal antibody against Aspergillus Species for ELISA, IFA.

APPL Rabbit Monoclonal Antibody

E10G21066 100 μl
EUR 275
Description: Biotin-Conjugated, FITC-Conjugated , AF350 Conjugated , AF405M-Conjugated ,AF488-Conjugated, AF514-Conjugated ,AF532-Conjugated, AF555-Conjugated ,AF568-Conjugated , HRP-Conjugated, AF405S-Conjugated, AF405L-Conjugated , AF546-Conjugated, AF594-Conjugated , AF610-Conjugated, AF635-Conjugated , AF647-Conjugated , AF680-Conjugated , AF700-Conjugated , AF750-Conjugated , AF790-Conjugated , APC-Conjugated , PE-Conjugated , Cy3-Conjugated , Cy5-Conjugated , Cy5.5-Conjugated , Cy7-Conjugated Antibody

Rabbit monoclonal antibody for Legionella pneumophila

6026 100 ug
EUR 503.7
Description: This is purified Rabbit monoclonal antibody against Legionella pneumophila serogroup 1 for ELISA, IFA.

APPBP1 Rabbit Monoclonal Antibody

E10G21065 100 μl
EUR 275
Description: Biotin-Conjugated, FITC-Conjugated , AF350 Conjugated , AF405M-Conjugated ,AF488-Conjugated, AF514-Conjugated ,AF532-Conjugated, AF555-Conjugated ,AF568-Conjugated , HRP-Conjugated, AF405S-Conjugated, AF405L-Conjugated , AF546-Conjugated, AF594-Conjugated , AF610-Conjugated, AF635-Conjugated , AF647-Conjugated , AF680-Conjugated , AF700-Conjugated , AF750-Conjugated , AF790-Conjugated , APC-Conjugated , PE-Conjugated , Cy3-Conjugated , Cy5-Conjugated , Cy5.5-Conjugated , Cy7-Conjugated Antibody

Rabbit monoclonal antibody for fungal beta-glucan

8201 100 ug
EUR 503.7
Description: This is purified Rabbit monoclonal antibody against fungal beta-glucan beta-glucan for ELISA, IFA.

Rabbit monoclonal antibody for Streptococcus group B

1525 100 ug
EUR 503.7
Description: This is purified Rabbit monoclonal antibody against Streptococcus group B group carbohydrate for ELISA, IFA.

Rabbit monoclonal antibody for Streptococcus group A

O435 100 ug
EUR 503.7
Description: This is purified Rabbit monoclonal antibody against Streptococcus group A group carbohydrate for ELISA, IFA.

PKC theta Rabbit Monoclonal Antibody

E10G22524 100 μl
EUR 275
Description: Biotin-Conjugated, FITC-Conjugated , AF350 Conjugated , AF405M-Conjugated ,AF488-Conjugated, AF514-Conjugated ,AF532-Conjugated, AF555-Conjugated ,AF568-Conjugated , HRP-Conjugated, AF405S-Conjugated, AF405L-Conjugated , AF546-Conjugated, AF594-Conjugated , AF610-Conjugated, AF635-Conjugated , AF647-Conjugated , AF680-Conjugated , AF700-Conjugated , AF750-Conjugated , AF790-Conjugated , APC-Conjugated , PE-Conjugated , Cy3-Conjugated , Cy5-Conjugated , Cy5.5-Conjugated , Cy7-Conjugated Antibody

14-3-3 theta Rabbit Monoclonal Antibody

E10G20991 100 μl
EUR 275
Description: Biotin-Conjugated, FITC-Conjugated , AF350 Conjugated , AF405M-Conjugated ,AF488-Conjugated, AF514-Conjugated ,AF532-Conjugated, AF555-Conjugated ,AF568-Conjugated , HRP-Conjugated, AF405S-Conjugated, AF405L-Conjugated , AF546-Conjugated, AF594-Conjugated , AF610-Conjugated, AF635-Conjugated , AF647-Conjugated , AF680-Conjugated , AF700-Conjugated , AF750-Conjugated , AF790-Conjugated , APC-Conjugated , PE-Conjugated , Cy3-Conjugated , Cy5-Conjugated , Cy5.5-Conjugated , Cy7-Conjugated Antibody

Anti-Dnmt3b Rabbit Monoclonal Antibody Rabbit Monoclonal Antibody

M00319 100ug/vial
EUR 476.4
Description: Rabbit Monoclonal Dnmt3b Antibody Antibody. Validated in IF, ICC, WB and tested in Human, Mouse, Rat.