First Ever Rabbit Monoclonal Antibody Approved For Therapeutics

Human IgG Rabbit monoclonal antibody

BS40555 50ul
EUR 298
Description: Rabbit IgG, 1mg/ml in PBS with 0.02% sodium azide, 50% glycerol, pH7.2.

Human IgG antibody Laboratories manufactures the first ever rabbit monoclonal antibody approved for therapeutics reagents distributed by Genprice. The First Ever Rabbit Monoclonal Antibody Approved For Therapeutics reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact rabbit Antibody. Other First products are available in stock. Specificity: First Category: Ever Group: Rabbit Monoclonal

ELISA kit for Human True insulin (TI)

48T
EUR 424.8
Description: Quantitative sandwich ELISA for measuring Human True insulin (TI) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human True insulin (TI)

5 plates of 96 wells
EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Human True insulin (TI) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human True insulin (TI)

96T
EUR 686.4
Description: Quantitative sandwich ELISA for measuring Human True insulin (TI) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Rabbit Monoclonal information

CeraVe Therapeutic Hand Cream , 3 Oz

LC3035-001 Ea
EUR 84

Recombinant Human GBA therapeutic protein

GBA-P024H 10ug
EUR 318.4

Recombinant Human GAA therapeutic protein

GAA-P026H 50ug
EUR 638.4

Recombinant Hu-rhEGF-rP64k/Mont Therapeutic Vaccine

THP-0327 1 vial
EUR 2398.4
Description: Protein

Recombinant Human CSF3 therapeutic protein

CSF3-P054H 20ug
EUR 158.4
Description: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.

Recombinant Human IDUA therapeutic protein

IDUA-P025H 5ug
EUR 238.4
Description: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.

Recombinant Human ACVR2B, Fc-tagged therapeutic protein

ACVR2B-P014H 100ug
EUR 958.4

Recombinant Human ActRIIA therapeutic protein, Fc-tagged

ACVR2A-P015H 100ug
EUR 958.4

Fetal Bovine Serum (Chile. USDA approved) - 100ml

FB-1365/100 100ml
EUR 43.4

Fetal Bovine Serum (Chile. USDA approved) - 500ml

FB-1365/500 500ml
EUR 195.58

Fetal Bovine Serum (Mexico. USDA approved) -100ml

FB-1360/100 100ml
EUR 50.71

Fetal Bovine Serum (Mexico. USDA approved) - 500ml

FB-1360/500 500ml
EUR 232.21

Fetal Bovine Serum (Central America. USDA approved) - 100ml

FB-1345/100 100ml
EUR 50.71

Fetal Bovine Serum (Central America. USDA approved) - 500ml

FB-1345/500 500ml
EUR 232.21

Fetal Bovine Serum (Chile. USDA approved) - 50ml

FB-1365/50 50ml
EUR 34.21

Fetal Bovine Serum (Mexico. USDA approved) - 50ml

FB-1360/50 50ml
EUR 38.12

DiscoveryProbe™ Clinical & FDA approved Drug Library

L1052-.096 100uL/well(10 mM solution),96 Well Deep Well Plate
EUR 5968
Description: Screening Library