First Ever Rabbit Monoclonal Antibody Approved For Therapeutics

Anti-Human IgG Rabbit Monoclonal Antibody

M04575 100ug/vial
EUR 476.4
Description: Rabbit Monoclonal Human IgG Antibody. Validated in WB and tested in Human.

Human IgG antibody Laboratories manufactures the first ever rabbit monoclonal antibody approved for therapeutics reagents distributed by Genprice. The First Ever Rabbit Monoclonal Antibody Approved For Therapeutics reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact rabbit Antibody. Other First products are available in stock. Specificity: First Category: Ever Group: Rabbit Monoclonal

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 470.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

Rabbit Monoclonal information

Rabbit monoclonal antibody for Candida albicans

6405 100 ug
EUR 503.7
Description: This is purified Rabbit monoclonal antibody against Candida albicans species for ELISA, IFA.

Rabbit monoclonal antibody for Strep pneumoniae

O493 100 ug
EUR 503.7
Description: This is purified Rabbit monoclonal antibody against Strep pneumoniae common for ELISA, IFA.

Rabbit monoclonal antibody for Strep pneumoniae

O494 100 ug
EUR 503.7
Description: This is purified Rabbit monoclonal antibody against Strep pneumoniae common for ELISA, IFA.

Rabbit monoclonal antibody for Strep pneumoniae

O495 100 ug
EUR 503.7
Description: This is purified Rabbit monoclonal antibody against Strep pneumoniae common for ELISA, IFA.

Rabbit monoclonal antibody for Aspergillus Species

5145 100 ug
EUR 503.7
Description: This is purified Rabbit monoclonal antibody against Aspergillus Species for ELISA, IFA.

Rabbit monoclonal antibody for Legionella pneumophila

6026 100 ug
EUR 503.7
Description: This is purified Rabbit monoclonal antibody against Legionella pneumophila serogroup 1 for ELISA, IFA.

Rabbit monoclonal antibody for fungal beta-glucan

8201 100 ug
EUR 503.7
Description: This is purified Rabbit monoclonal antibody against fungal beta-glucan beta-glucan for ELISA, IFA.

Rabbit monoclonal antibody for Streptococcus group B

1525 100 ug
EUR 503.7
Description: This is purified Rabbit monoclonal antibody against Streptococcus group B group carbohydrate for ELISA, IFA.

Rabbit monoclonal antibody for Streptococcus group A

O435 100 ug
EUR 503.7
Description: This is purified Rabbit monoclonal antibody against Streptococcus group A group carbohydrate for ELISA, IFA.

Anti-Dnmt3b Rabbit Monoclonal Antibody Rabbit Monoclonal Antibody

M00319 100ug/vial
EUR 476.4
Description: Rabbit Monoclonal Dnmt3b Antibody Antibody. Validated in IF, ICC, WB and tested in Human, Mouse, Rat.

Rabbit monoclonal anti-B3AT antibody for SISCAPA, clone OTIR5D8

TA591014 100 µl Ask for price

Rabbit monoclonal anti-PML antibody for SISCAPA, clone OTIR1H2

TA591018 100 µl Ask for price

Rabbit monoclonal anti-TKT antibody for SISCAPA, clone OTIR4F5

TA591022 100 µl Ask for price

Rabbit monoclonal anti-TAGL antibody for SISCAPA, clone OTIR1F8

TA591013 100 µl Ask for price

Rabbit monoclonal anti-RFA2 antibody for SISCAPA, clone OTIR2G2

TA591019 100 µl Ask for price

Rabbit monoclonal anti-EBP2 antibody for SISCAPA, clone OTIR3D2

TA591021 100 µl Ask for price

Rabbit monoclonal anti-RMD3 antibody for SISCAPA, clone OTIR1A2

TA591023 100 µl Ask for price