First Ever Rabbit Monoclonal Antibody Approved For Therapeutics

Anti-Human IgG Rabbit Monoclonal Antibody

M04575 100ug/vial
EUR 476.4
Description: Rabbit Monoclonal Human IgG Antibody. Validated in WB and tested in Human.

Human IgG antibody Laboratories manufactures the first ever rabbit monoclonal antibody approved for therapeutics reagents distributed by Genprice. The First Ever Rabbit Monoclonal Antibody Approved For Therapeutics reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact rabbit Antibody. Other First products are available in stock. Specificity: First Category: Ever Group: Rabbit Monoclonal

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Rabbit Monoclonal information

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC701520-500 500uL
EUR 652.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF770 conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC881520-100 100uL
EUR 238.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF488A conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC881520-500 500uL
EUR 652.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF488A conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC051520-100 100uL
EUR 238.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF405M conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC051520-500 500uL
EUR 652.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF405M conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC041520-100 100uL
EUR 238.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF405S conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC041520-500 500uL
EUR 652.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF405S conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC401520-100 100uL
EUR 238.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF640R conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNC401520-500 500uL
EUR 652.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF640R conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCAP1520-100 100uL
EUR 238.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Alkaline Phosphatase conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCAP1520-500 500uL
EUR 652.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Alkaline Phosphatase conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCA1520-250 250uL
EUR 459.6
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),APC conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCR1520-250 250uL
EUR 459.6
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),RPE conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCH1520-100 100uL
EUR 238.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Horseradish Peroxidase conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCH1520-500 500uL
EUR 652.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Horseradish Peroxidase conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCP1520-250 250uL
EUR 459.6
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),PerCP conjugate, Concentration: 0.1mg/mL

Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody

BNCB1520-100 100uL
EUR 238.8
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Biotin conjugate, Concentration: 0.1mg/mL